PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08274A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 194aa    MW: 20537.4 Da    PI: 8.282
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08274AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.65.2e-44211201100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++Cv+apyfp ++p+kfanvhk+FGasnv+k+l+++p ++r d++sslvyeA+ar+rdPvyG+v+ i++lq
  Oropetium_20150105_08274A  21 PCAACKLLRRRCAAGCVFAPYFPPAEPHKFANVHKVFGASNVSKMLQEIPVQHRGDTVSSLVYEANARIRDPVYGCVAAISSLQ 104
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                qq+e+l+a+lal+++e
  Oropetium_20150105_08274A 105 QQVETLQAQLALAQAE 120
                                ************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.25620121IPR004883Lateral organ boundaries, LOB
PfamPF031959.9E-4421118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MKDEFAPVAG KAGASSSASA PCAACKLLRR RCAAGCVFAP YFPPAEPHKF ANVHKVFGAS  60
NVSKMLQEIP VQHRGDTVSS LVYEANARIR DPVYGCVAAI SSLQQQVETL QAQLALAQAE  120
MVRLNMNNAY MAHRLKAARG CGGGGSSTNT GSPSSMSSPK TEQPEAHCKA TPALLDMVVD  180
QPYSMDDSQL WSY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0699111e-154BT069911.1 Zea mays full-length cDNA clone ZM_BFb0321D10 mRNA, complete cds.
GenBankKJ7276501e-154KJ727650.1 Zea mays clone pUT5577 LOB transcription factor (LOB19) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002466719.12e-84hypothetical protein SORBIDRAFT_01g012810
SwissprotQ8LBW32e-56LBD12_ARATH; LOB domain-containing protein 12
TrEMBLC5WQF32e-84C5WQF3_SORBI; Putative uncharacterized protein Sb01g012810
STRINGSb01g012810.15e-84(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-36LOB domain-containing protein 4